Recombinant Human Alkaline phosphatase, placental type (ALPP), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20894
Artikelname: Recombinant Human Alkaline phosphatase, placental type (ALPP), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20894
Hersteller Artikelnummer: RPC20894
Alternativnummer: BIM-RPC20894-20UG,BIM-RPC20894-100UG,BIM-RPC20894-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Alkaline phosphatase Regan isozymePlacental alkaline phosphatase 1PLAP
Recombinant Human Alkaline phosphatase, placental type (ALPP), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ALPP. Target Synonyms: Alkaline phosphatase Regan isozymePlacental alkaline phosphatase 1PLAP. Accession Number: P05187. Expression Region: 117~447aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 41.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.9kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEED
Target-Kategorie: ALPP