Recombinant Human Annexin A4 (ANXA4), Unconjugated, E. coli

Artikelnummer: BIM-RPC20904
Artikelname: Recombinant Human Annexin A4 (ANXA4), Unconjugated, E. coli
Artikelnummer: BIM-RPC20904
Hersteller Artikelnummer: RPC20904
Alternativnummer: BIM-RPC20904-20UG,BIM-RPC20904-100UG,BIM-RPC20904-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 35-beta calcimedinAnnexin IVAnnexin-4Carbohydrate-binding protein p33/p41Chromobindin-4Endonexin ILipocortin IVP32.5PP4-XPlacental anticoagulant protein II
Recombinant Human Annexin A4 (ANXA4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ANXA4. Target Synonyms: 35-beta calcimedinAnnexin IVAnnexin-4Carbohydrate-binding protein p33/p41Chromobindin-4Endonexin ILipocortin IVP32.5PP4-XPlacental anticoagulant protein II. Accession Number: P09525. Expression Region: 2~319aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 55.8kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYK
Target-Kategorie: ANXA4