Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3), Unconjugated, E. coli

Artikelnummer: BIM-RPC20948
Artikelname: Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3), Unconjugated, E. coli
Artikelnummer: BIM-RPC20948
Hersteller Artikelnummer: RPC20948
Alternativnummer: BIM-RPC20948-20UG,BIM-RPC20948-100UG,BIM-RPC20948-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Activating transcription factor 3
Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATF3. Target Synonyms: Activating transcription factor 3. Accession Number: P18847. Expression Region: 1~181aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 26.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Target-Kategorie: ATF3