Recombinant Human Brain-derived neurotrophic factor (BDNF), Unconjugated, E. coli

Artikelnummer: BIM-RPC20975
Artikelname: Recombinant Human Brain-derived neurotrophic factor (BDNF), Unconjugated, E. coli
Artikelnummer: BIM-RPC20975
Hersteller Artikelnummer: RPC20975
Alternativnummer: BIM-RPC20975-20UG,BIM-RPC20975-100UG,BIM-RPC20975-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Abrineurin
Recombinant Human Brain-derived neurotrophic factor (BDNF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: BDNF. Target Synonyms: Abrineurin. Accession Number: P23560. Expression Region: 129~247aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 29.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Target-Kategorie: BDNF