Recombinant Human Calmodulin-like protein 3 (CALML3), Unconjugated, E. coli

Artikelnummer: BIM-RPC21014
Artikelname: Recombinant Human Calmodulin-like protein 3 (CALML3), Unconjugated, E. coli
Artikelnummer: BIM-RPC21014
Hersteller Artikelnummer: RPC21014
Alternativnummer: BIM-RPC21014-20UG,BIM-RPC21014-100UG,BIM-RPC21014-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: CaM-like protein
Recombinant Human Calmodulin-like protein 3 (CALML3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CALML3. Target Synonyms: CaM-like protein. Accession Number: P27482. Expression Region: 1~149aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 43.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 43.9kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Target-Kategorie: CALML3