Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21054
Artikelname: Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21054
Hersteller Artikelnummer: RPC21054
Alternativnummer: BIM-RPC21054-20UG,BIM-RPC21054-100UG,BIM-RPC21054-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Sialic acid-binding Ig-like lectin 3Siglec-3gp67CD_antigen: CD33SIGLEC3
Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CD33. Target Synonyms: Sialic acid-binding Ig-like lectin 3Siglec-3gp67CD_antigen: CD33SIGLEC3. Accession Number: P20138. Expression Region: 18~259aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 46.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Target-Kategorie: CD33