Recombinant Human CD59 glycoprotein (CD59), Unconjugated, E. coli

Artikelnummer: BIM-RPC21062
Artikelname: Recombinant Human CD59 glycoprotein (CD59), Unconjugated, E. coli
Artikelnummer: BIM-RPC21062
Hersteller Artikelnummer: RPC21062
Alternativnummer: BIM-RPC21062-20UG,BIM-RPC21062-100UG,BIM-RPC21062-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 1F5 antigen20 kDa homologous restriction factor, HRF-20, HRF20MAC-inhibitory protein, MAC-IPMEM43 antigen, Membrane attack complex inhibition factor, MACIF, Membrane inhibitor of reactive lysis, MIRLProtectin, CD59
Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CD59. Target Synonyms: 1F5 antigen20 kDa homologous restriction factor, HRF-20, HRF20MAC-inhibitory protein, MAC-IPMEM43 antigen, Membrane attack complex inhibition factor, MACIF, Membrane inhibitor of reactive lysis, MIRLProtectin, CD59. Accession Number: P13987. Expression Region: 26~102aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 36kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Target-Kategorie: CD59