Recombinant Human Cerebellar degeneration-related protein 2 (CDR2), Unconjugated, E. coli

Artikelnummer: BIM-RPC21078
Artikelname: Recombinant Human Cerebellar degeneration-related protein 2 (CDR2), Unconjugated, E. coli
Artikelnummer: BIM-RPC21078
Hersteller Artikelnummer: RPC21078
Alternativnummer: BIM-RPC21078-20UG,BIM-RPC21078-100UG,BIM-RPC21078-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Major Yo paraneoplastic antigen, Paraneoplastic cerebellar degeneration-associated antigen
Recombinant Human Cerebellar degeneration-related protein 2 (CDR2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CDR2 PCD17. Target Synonyms: Major Yo paraneoplastic antigen, Paraneoplastic cerebellar degeneration-associated antigen. Accession Number: Q01850. Expression Region: 1~454aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 55.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 55.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVA
Target-Kategorie: CDR2 PCD17