Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21097
Artikelname: Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21097
Hersteller Artikelnummer: RPC21097
Alternativnummer: BIM-RPC21097-20UG,BIM-RPC21097-100UG,BIM-RPC21097-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Acetylcholine receptor subunit alpha, ACHA_HUMAN, AChR, ACHRA, ACHRD, CHNRA, Cholinergic receptor nicotinic alpha 1 subunit, Cholinergic receptor nicotinic alpha polypeptide 1, Cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle), Chrna1, CMS1A, CMS1B, CMS2A, FCCMS, Nicotinic cholinergic receptor alpha 1, SCCMS, Schizophrenia neurophysiologic defect candidate
Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CHRNA1. Target Synonyms: Acetylcholine receptor subunit alpha, ACHA_HUMAN, AChR, ACHRA, ACHRD, CHNRA, Cholinergic receptor nicotinic alpha 1 subunit, Cholinergic receptor nicotinic alpha polypeptide 1, Cholinergic receptor, nicotinic. Accession Number: P02708. Expression Region: 21~255aa. Tag Info: N-Terminal 6Xhis-Trx-Tagged. Theoretical MW: 44.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.1kDa
Tag: N-Terminal 6Xhis-Trx-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL
Target-Kategorie: CHRNA1