Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21098
Artikelname: Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21098
Hersteller Artikelnummer: RPC21098
Alternativnummer: BIM-RPC21098-20UG,BIM-RPC21098-100UG,BIM-RPC21098-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: ACHA3_HUMAN, AChR, Cholinergic receptor neuronal nicotinic alpha polypeptide 3, Cholinergic receptor nicotinic alpha 3, Cholinergic receptor nicotinic alpha polypeptide 3, CHRNA 3, CHRNA3, LNCR2, MGC104879, NACHRA 3, NACHRA3, Neuronal acetylcholine receptor protein alpha 3 chain precursor, Neuronal acetylcholine receptor subunit alpha 3, Neuronal acetylcholine receptor subunit alpha-3, Neuronal nicotinic acetylcholine receptor alpha 3 subunit, PAOD2
Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CHRNA3. Target Synonyms: ACHA3_HUMAN, AChR, Cholinergic receptor neuronal nicotinic alpha polypeptide 3, Cholinergic receptor nicotinic alpha 3, Cholinergic receptor nicotinic alpha polypeptide 3, CHRNA 3, CHRNA3, LNCR2, MGC104879, NACHRA 3. Accession Number: P32297. Expression Region: 32~240aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 44.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.6kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Target-Kategorie: CHRNA3