Recombinant Mouse Cold-inducible RNA-binding protein (Cirbp), Unconjugated, E. coli

Artikelnummer: BIM-RPC21100
Artikelname: Recombinant Mouse Cold-inducible RNA-binding protein (Cirbp), Unconjugated, E. coli
Artikelnummer: BIM-RPC21100
Hersteller Artikelnummer: RPC21100
Alternativnummer: BIM-RPC21100-20UG,BIM-RPC21100-100UG,BIM-RPC21100-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: A18 hnRNPGlycine-rich RNA-binding protein CIRPCirp
Recombinant Mouse Cold-inducible RNA-binding protein (Cirbp) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Cirbp. Target Synonyms: A18 hnRNPGlycine-rich RNA-binding protein CIRPCirp. Accession Number: P60824. Expression Region: 1~172aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Target-Kategorie: Cirbp