Recombinant Human C-type lectin domain family 18 member A (CLEC18A), Unconjugated, E. coli

Artikelnummer: BIM-RPC21103
Artikelname: Recombinant Human C-type lectin domain family 18 member A (CLEC18A), Unconjugated, E. coli
Artikelnummer: BIM-RPC21103
Hersteller Artikelnummer: RPC21103
Alternativnummer: BIM-RPC21103-20UG,BIM-RPC21103-100UG,BIM-RPC21103-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Mannose receptor-like protein 2
Recombinant Human C-type lectin domain family 18 member A (CLEC18A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CLEC18A. Target Synonyms: Mannose receptor-like protein 2. Accession Number: A5D8T8. Expression Region: 27~446aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 62.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 62.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMRRLDWSDSLAQLAQARAALCGTPTPSLASGLWRTLQVGWNMQLLPAGLVSFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCV
Target-Kategorie: CLEC18A