Recombinant Dog Chymase (CMA1), Unconjugated, E. coli

Artikelnummer: BIM-RPC21111
Artikelname: Recombinant Dog Chymase (CMA1), Unconjugated, E. coli
Artikelnummer: BIM-RPC21111
Hersteller Artikelnummer: RPC21111
Alternativnummer: BIM-RPC21111-20UG,BIM-RPC21111-100UG,BIM-RPC21111-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Canine
Konjugation: Unconjugated
Alternative Synonym: Alpha-chymase, Mast cell protease I
Recombinant Dog Chymase (CMA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris, Canine). Target Name: CMA1. Target Synonyms: Alpha-chymase, Mast cell protease I. Accession Number: P21842. Expression Region: 22~249aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 41.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Target-Kategorie: CMA1