Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1), Unconjugated, E. coli

Artikelnummer: BIM-RPC21123
Artikelname: Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1), Unconjugated, E. coli
Artikelnummer: BIM-RPC21123
Hersteller Artikelnummer: RPC21123
Alternativnummer: BIM-RPC21123-20UG,BIM-RPC21123-100UG,BIM-RPC21123-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1, COX IV-1
Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: COX4I1. Target Synonyms: Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1, COX IV-1. Accession Number: P13073. Expression Region: 23~169aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Target-Kategorie: COX4I1