Recombinant Human Complement receptor type 1 (CR1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21129
Artikelname: Recombinant Human Complement receptor type 1 (CR1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21129
Hersteller Artikelnummer: RPC21129
Alternativnummer: BIM-RPC21129-20UG,BIM-RPC21129-100UG,BIM-RPC21129-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: C3b/C4b receptorCD_antigen: CD35
Recombinant Human Complement receptor type 1 (CR1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CR1. Target Synonyms: C3b/C4b receptorCD_antigen: CD35. Accession Number: P17927. Expression Region: 41~234aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 48.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 48.4kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
Target-Kategorie: CR1