Recombinant Human Cyclic AMP-responsive element-binding protein 1 (CREB1), Unconjugated, E. coli

Artikelnummer: BIM-RPC21135
Artikelname: Recombinant Human Cyclic AMP-responsive element-binding protein 1 (CREB1), Unconjugated, E. coli
Artikelnummer: BIM-RPC21135
Hersteller Artikelnummer: RPC21135
Alternativnummer: BIM-RPC21135-20UG,BIM-RPC21135-100UG,BIM-RPC21135-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Active transcription factor CREB, cAMP response element binding protein 1, cAMP response element binding protein, cAMP responsive element binding protein 1, cAMP-responsive element-binding protein 1, CREB, CREB-1, CREB1, CREB1_HUMAN, Cyclic AMP-responsive element-binding protein 1, MGC9284, OTTHUMP00000163864, OTTHUMP00000163865, OTTHUMP00000206660, OTTHUMP00000206662, OTTHUMP00000206667, Transactivator protein
Recombinant Human Cyclic AMP-responsive element-binding protein 1 (CREB1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CREB1. Target Synonyms: Active transcription factor CREB, cAMP response element binding protein 1, cAMP response element binding protein, cAMP responsive element binding protein 1. Accession Number: P16220. Expression Region: 1~341aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 40.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 40.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIR
Target-Kategorie: CREB1