Recombinant Human Cancer/testis antigen 1 (CTAG1A), Unconjugated, E. coli

Artikelnummer: BIM-RPC21152
Artikelname: Recombinant Human Cancer/testis antigen 1 (CTAG1A), Unconjugated, E. coli
Artikelnummer: BIM-RPC21152
Hersteller Artikelnummer: RPC21152
Alternativnummer: BIM-RPC21152-20UG,BIM-RPC21152-100UG,BIM-RPC21152-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Autoimmunogenic cancer/testis antigen NY-ESO-1Cancer/testis antigen 6.1
Recombinant Human Cancer/testis antigen 1 (CTAG1A) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CTAG1A. Target Synonyms: Autoimmunogenic cancer/testis antigen NY-ESO-1Cancer/testis antigen 6.1. Accession Number: P78358. Expression Region: 1~180aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.5kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Target-Kategorie: CTAG1A