Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21155
Artikelname: Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21155
Hersteller Artikelnummer: RPC21155
Alternativnummer: BIM-RPC21155-20UG,BIM-RPC21155-100UG,BIM-RPC21155-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Cytotoxic T-lymphocyte-associated antigen 4
Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ctla4. Target Synonyms: Cytotoxic T-lymphocyte-associated antigen 4. Accession Number: P09793. Expression Region: 36~161aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.9kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Target-Kategorie: Ctla4