Recombinant Cricetulus griseus Cathepsin D (Ctsd), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21157
Artikelname: Recombinant Cricetulus griseus Cathepsin D (Ctsd), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21157
Hersteller Artikelnummer: RPC21157
Alternativnummer: BIM-RPC21157-20UG,BIM-RPC21157-100UG,BIM-RPC21157-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Hamster
Konjugation: Unconjugated
Recombinant Cricetulus griseus Cathepsin D (Ctsd), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Target Name: H671_3g9701. Accession Number: G3I4W7. Expression Region: 65~408aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 53.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQG
Target-Kategorie: H671_3g9701