Recombinant Human Receptor tyrosine-protein kinase erbB-2 (ERBB2), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21276
Artikelname: Recombinant Human Receptor tyrosine-protein kinase erbB-2 (ERBB2), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21276
Hersteller Artikelnummer: RPC21276
Alternativnummer: BIM-RPC21276-20UG,BIM-RPC21276-100UG,BIM-RPC21276-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Metastatic lymph node gene 19 protein, MLN 19Proto-oncogene NeuProto-oncogene c-ErbB-2Tyrosine kinase-type cell surface receptor HER2p185erbB2,, CD340
Recombinant Human Receptor tyrosine-protein kinase erbB-2 (ERBB2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ERBB2. Target Synonyms: Metastatic lymph node gene 19 protein, MLN 19Proto-oncogene NeuProto-oncogene c-ErbB-2Tyrosine kinase-type cell surface receptor HER2p185erbB2,, CD340. Accession Number: P04626. Expression Region: 23~652aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 73.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 73.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTD
Target-Kategorie: ERBB2