Recombinant Mouse Frataxin, mitochondrial (Fxn), Unconjugated, E. coli

Artikelnummer: BIM-RPC21343
Artikelname: Recombinant Mouse Frataxin, mitochondrial (Fxn), Unconjugated, E. coli
Artikelnummer: BIM-RPC21343
Hersteller Artikelnummer: RPC21343
Alternativnummer: BIM-RPC21343-20UG,BIM-RPC21343-100UG,BIM-RPC21343-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Fxn, FrdaFrataxin, mitochondrial, Fxn, EC 1.16.3.1, Cleaved into: Frataxin intermediate form, Frataxin mature form
Recombinant Mouse Frataxin, mitochondrial (Fxn) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Fxn. Target Synonyms: Fxn, FrdaFrataxin, mitochondrial, Fxn, EC 1.16.3.1, Cleaved into: Frataxin intermediate form, Frataxin mature form. Accession Number: O35943. Expression Region: 78~207aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT
Target-Kategorie: Fxn