Recombinant Human Pro-glucagon (GCG), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21362
Artikelname: Recombinant Human Pro-glucagon (GCG), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21362
Hersteller Artikelnummer: RPC21362
Alternativnummer: BIM-RPC21362-20UG,BIM-RPC21362-100UG,BIM-RPC21362-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Incretin hormone
Recombinant Human Pro-glucagon (GCG), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GCG. Target Synonyms: Incretin hormone. Accession Number: P01275. Expression Region: 53~89aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 30.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.4kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Target-Kategorie: GCG