Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21382
Artikelname: Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21382
Hersteller Artikelnummer: RPC21382
Alternativnummer: BIM-RPC21382-20UG,BIM-RPC21382-100UG,BIM-RPC21382-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: GLP-1 receptorGLP-1-RGLP-1R
Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Glp1r. Target Synonyms: GLP-1 receptorGLP-1-RGLP-1R. Accession Number: P32301. Expression Region: 22~135aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
Target-Kategorie: Glp1r