Recombinant Human Glycogen synthase kinase-3 beta (GSK3B), Unconjugated, E. coli

Artikelnummer: BIM-RPC21411
Artikelname: Recombinant Human Glycogen synthase kinase-3 beta (GSK3B), Unconjugated, E. coli
Artikelnummer: BIM-RPC21411
Hersteller Artikelnummer: RPC21411
Alternativnummer: BIM-RPC21411-20UG,BIM-RPC21411-100UG,BIM-RPC21411-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Serine/threonine-protein kinase GSK3B
Recombinant Human Glycogen synthase kinase-3 beta (GSK3B) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GSK3B. Target Synonyms: Serine/threonine-protein kinase GSK3B. Accession Number: P49841. Expression Region: 1~420aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 50.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQP
Target-Kategorie: GSK3B