Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1), Unconjugated, E. coli

Artikelnummer: BIM-RPC21412
Artikelname: Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1), Unconjugated, E. coli
Artikelnummer: BIM-RPC21412
Hersteller Artikelnummer: RPC21412
Alternativnummer: BIM-RPC21412-20UG,BIM-RPC21412-100UG,BIM-RPC21412-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: GST 1-1, GST 1a-1a, GST A1-1, GST B, Glutathione S-transferase Ya-1, GST Ya1, Ligandin
Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Gsta1. Target Synonyms: GST 1-1, GST 1a-1a, GST A1-1, GST B, Glutathione S-transferase Ya-1, GST Ya1, Ligandin. Accession Number: P00502. Expression Region: 2~222aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 41.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Target-Kategorie: Gsta1