Recombinant Human Granzyme B (GZMB), Unconjugated, E. coli

Artikelnummer: BIM-RPC21426
Artikelname: Recombinant Human Granzyme B (GZMB), Unconjugated, E. coli
Artikelnummer: BIM-RPC21426
Hersteller Artikelnummer: RPC21426
Alternativnummer: BIM-RPC21426-20UG,BIM-RPC21426-100UG,BIM-RPC21426-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: C11CTLA-1Cathepsin G-like 1, CTSGL1Cytotoxic T-lymphocyte proteinase 2, Lymphocyte proteaseFragmentin-2Granzyme-2Human lymphocyte protein, HLPSECTT-cell serine protease 1-3E
Recombinant Human Granzyme B (GZMB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GZMB. Target Synonyms: C11CTLA-1Cathepsin G-like 1, CTSGL1Cytotoxic T-lymphocyte proteinase 2, Lymphocyte proteaseFragmentin-2Granzyme-2Human lymphocyte protein, HLPSECTT-cell serine protease 1-3E. Accession Number: P10144. Expression Region: 21~247aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 31.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.0kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Target-Kategorie: GZMB