Recombinant Human Histone H2B type 1-B (H2BC3), Unconjugated, E. coli

Artikelnummer: BIM-RPC21449
Artikelname: Recombinant Human Histone H2B type 1-B (H2BC3), Unconjugated, E. coli
Artikelnummer: BIM-RPC21449
Hersteller Artikelnummer: RPC21449
Alternativnummer: BIM-RPC21449-20UG,BIM-RPC21449-100UG,BIM-RPC21449-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Histone H2B.1Histone H2B.f, H2B/f
Recombinant Human Histone H2B type 1-B (H2BC3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HIST1H2BB. Target Synonyms: Histone H2B.1Histone H2B.f, H2B/f. Accession Number: P33778. Expression Region: 2~126aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 29.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Target-Kategorie: HIST1H2BB