Recombinant Human Heterogeneous nuclear ribonucleoprotein H (HNRNPH1), Unconjugated, E. coli

Artikelnummer: BIM-RPC21465
Artikelname: Recombinant Human Heterogeneous nuclear ribonucleoprotein H (HNRNPH1), Unconjugated, E. coli
Artikelnummer: BIM-RPC21465
Hersteller Artikelnummer: RPC21465
Alternativnummer: BIM-RPC21465-20UG,BIM-RPC21465-100UG,BIM-RPC21465-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: DKFZp686A15170, Heterogeneous nuclear ribonucleoprotein H, Heterogeneous nuclear ribonucleoprotein H1 (H), Heterogeneous nuclear ribonucleoprotein H1, HNRH1_HUMAN, hnRNP H, hnRNPH, Hnrnph1, HNRPH 1, HNRPH, HNRPH1 protein, N-terminally processed
Recombinant Human Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HNRNPH1. Target Synonyms: DKFZp686A15170, Heterogeneous nuclear ribonucleoprotein H, Heterogeneous nuclear ribonucleoprotein H1 (H), Heterogeneous nuclear ribonucleoprotein H1, HNRH1_HUMAN, hnRNP H, hnRNPH, Hnrnph1, HNRPH 1, HNRPH, HNRPH1 protein, N-terminally processed. Accession Number: P31943. Expression Region: 2~449aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 65.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 65.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFG
Target-Kategorie: HNRNPH1