Recombinant Human Interleukin-6 (IL6), Unconjugated, E. coli

Artikelnummer: BIM-RPC21522
Artikelname: Recombinant Human Interleukin-6 (IL6), Unconjugated, E. coli
Artikelnummer: BIM-RPC21522
Hersteller Artikelnummer: RPC21522
Alternativnummer: BIM-RPC21522-20UG,BIM-RPC21522-100UG,BIM-RPC21522-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: B-cell stimulatory factor 2, BSF-2, CTL differentiation factor, CDFHybridoma growth factorInterferon beta-2, IFN-beta-2
Recombinant Human Interleukin-6 (IL6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IL6. Target Synonyms: B-cell stimulatory factor 2, BSF-2, CTL differentiation factor, CDFHybridoma growth factorInterferon beta-2, IFN-beta-2. Accession Number: P05231. Expression Region: 30~212aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 24.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Target-Kategorie: IL6