Recombinant Human Keratin, type I cytoskeletal 10 (KRT10), Unconjugated, E. coli

Artikelnummer: BIM-RPC21575
Artikelname: Recombinant Human Keratin, type I cytoskeletal 10 (KRT10), Unconjugated, E. coli
Artikelnummer: BIM-RPC21575
Hersteller Artikelnummer: RPC21575
Alternativnummer: BIM-RPC21575-20UG,BIM-RPC21575-100UG,BIM-RPC21575-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cytokeratin-10, CK-10Keratin-10, K10
Recombinant Human Keratin, type I cytoskeletal 10 (KRT10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KRT10. Target Synonyms: Cytokeratin-10, CK-10Keratin-10, K10. Accession Number: P13645. Expression Region: 1~584aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 62.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 62.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEADINGL
Target-Kategorie: KRT10