Recombinant Human Lymphocyte activation gene 3 protein (LAG3), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21585
Artikelname: Recombinant Human Lymphocyte activation gene 3 protein (LAG3), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21585
Hersteller Artikelnummer: RPC21585
Alternativnummer: BIM-RPC21585-20UG,BIM-RPC21585-100UG,BIM-RPC21585-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Protein FDC, CD223
Recombinant Human Lymphocyte activation gene 3 protein (LAG3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LAG3. Target Synonyms: Protein FDC, CD223. Accession Number: P18627. Expression Region: 29~450aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 75.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 75.6kDa
Tag: N-Terminal 6Xhis-Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: VPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCR
Target-Kategorie: LAG3