Recombinant Human Hepatocyte growth factor receptor (MET), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21662
Artikelname: Recombinant Human Hepatocyte growth factor receptor (MET), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21662
Hersteller Artikelnummer: RPC21662
Alternativnummer: BIM-RPC21662-20UG,BIM-RPC21662-100UG,BIM-RPC21662-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: HGF/SF receptorProto-oncogene c-MetScatter factor receptorSF receptorTyrosine-protein kinase Met
Recombinant Human Hepatocyte growth factor receptor (MET), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MET. Target Synonyms: HGF/SF receptorProto-oncogene c-MetScatter factor receptorSF receptorTyrosine-protein kinase Met. Accession Number: P08581. Expression Region: 52~562aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 59.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 59.4kDa
Tag: C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: IQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTEKRKK
Target-Kategorie: MET