Recombinant Rat Matrilysin (Mmp7), Unconjugated, E. coli

Artikelnummer: BIM-RPC21675
Artikelname: Recombinant Rat Matrilysin (Mmp7), Unconjugated, E. coli
Artikelnummer: BIM-RPC21675
Hersteller Artikelnummer: RPC21675
Alternativnummer: BIM-RPC21675-20UG,BIM-RPC21675-100UG,BIM-RPC21675-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Matrin, Matrix metalloproteinase-7, MMP-7Pump-1 proteaseUterine metalloproteinase
Recombinant Rat Matrilysin (Mmp7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Mmp7. Target Synonyms: Matrin, Matrix metalloproteinase-7, MMP-7Pump-1 proteaseUterine metalloproteinase. Accession Number: P50280. Expression Region: 98~267aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 45.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 45.9kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Target-Kategorie: Mmp7