Recombinant Human Macrophage mannose receptor 1 (MRC1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21685
Artikelname: Recombinant Human Macrophage mannose receptor 1 (MRC1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21685
Hersteller Artikelnummer: RPC21685
Alternativnummer: BIM-RPC21685-20UG,BIM-RPC21685-100UG,BIM-RPC21685-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: C-type lectin domain family 13 member DC-type lectin domain family 13 member D-likeHuman mannose receptorhMRMacrophage mannose receptor 1-like protein 1CD_antigen: CD206CLEC13D, CLEC13DL, MRC1L1
Recombinant Human Macrophage mannose receptor 1 (MRC1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MRC1. Target Synonyms: C-type lectin domain family 13 member DC-type lectin domain family 13 member D-likeHuman mannose receptorhMRMacrophage mannose receptor 1-like protein 1CD_antigen: CD206CLEC13D, CLEC13DL, MRC1L1. Accession Number: P22897. Expression Region: 655~1213aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 69.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 69.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFW
Target-Kategorie: MRC1