Recombinant Human Metallothionein-4 (MT4), Unconjugated, E. coli

Artikelnummer: BIM-RPC21698
Artikelname: Recombinant Human Metallothionein-4 (MT4), Unconjugated, E. coli
Artikelnummer: BIM-RPC21698
Hersteller Artikelnummer: RPC21698
Alternativnummer: BIM-RPC21698-20UG,BIM-RPC21698-100UG,BIM-RPC21698-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Metallothionein-IV
Recombinant Human Metallothionein-4 (MT4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MT4. Target Synonyms: Metallothionein-IV. Accession Number: P47944. Expression Region: 1~62aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 22.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP
Target-Kategorie: MT4