Recombinant Saccharomyces cerevisiae Translation initiation factor IF-2, mitochondrial (IFM1), Unconjugated, E. coli

Artikelnummer: BIM-RPC22562
Artikelname: Recombinant Saccharomyces cerevisiae Translation initiation factor IF-2, mitochondrial (IFM1), Unconjugated, E. coli
Artikelnummer: BIM-RPC22562
Hersteller Artikelnummer: RPC22562
Alternativnummer: BIM-RPC22562-20UG,BIM-RPC22562-100UG,BIM-RPC22562-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Yeast
Konjugation: Unconjugated
Alternative Synonym: IFM1, YOL023WTranslation initiation factor IF-2, mitochondrial, IF-2(Mt), IF-2Mt, IF2(mt)
Recombinant Saccharomyces cerevisiae Translation initiation factor IF-2, mitochondrial (IFM1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Target Name: IFM1. Target Synonyms: IFM1, YOL023WTranslation initiation factor IF-2, mitochondrial, IF-2(Mt), IF-2Mt, IF2(mt). Accession Number: P25038. Expression Region: 43~676aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 97.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 97.5kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: KGKRRNQISKKELKPLNFSIPNYISVNKLANLLNCRVERLIKDLTALGFENITTTYILSKEYVELILQEYNFALPNLSTSTNLDNVYDELKSPVNPKLLTKRAPVVTIMGHVDHGKTTIIDYLRKSSVVAQEHGGITQHIGAFQITAPKSGKKITFLDTPGHAAFLKMRERGANITDIIVLVVSVEDSLMPQTLEAIKHAKNSGNEMIIAITKIDRIPQPKEREKKIEKVINDLIVQGIPVEKIGGDVQVIPISA
Target-Kategorie: IFM1