Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC24733
Artikelname: Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC24733
Hersteller Artikelnummer: RPC24733
Alternativnummer: BIM-RPC24733-20UG,BIM-RPC24733-100UG,BIM-RPC24733-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Type I interferon receptor 2
Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ifnar2. Target Synonyms: Type I interferon receptor 2. Accession Number: O35664. Expression Region: 22~242aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 26.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
Target-Kategorie: Ifnar2