Recombinant Sheep Interleukin-4 (IL4), Unconjugated, Yeast

Artikelnummer: BIM-RPC24752
Artikelname: Recombinant Sheep Interleukin-4 (IL4), Unconjugated, Yeast
Artikelnummer: BIM-RPC24752
Hersteller Artikelnummer: RPC24752
Alternativnummer: BIM-RPC24752-20UG,BIM-RPC24752-100UG,BIM-RPC24752-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Sheep
Konjugation: Unconjugated
Alternative Synonym: B-cell stimulatory factor 1
Recombinant Sheep Interleukin-4 (IL4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries). Target Name: IL4. Target Synonyms: B-cell stimulatory factor 1. Accession Number: P30368. Expression Region: 25~135aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 14.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
Target-Kategorie: IL4