Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC24767
Artikelname: Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC24767
Hersteller Artikelnummer: RPC24767
Alternativnummer: BIM-RPC24767-20UG,BIM-RPC24767-100UG,BIM-RPC24767-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Janus kinase 1JAK-1
Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: JAK1. Target Synonyms: Janus kinase 1JAK-1. Accession Number: P23458. Expression Region: 850~1154aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 36.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRL
Target-Kategorie: JAK1