Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC24831
Artikelname: Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC24831
Hersteller Artikelnummer: RPC24831
Alternativnummer: BIM-RPC24831-20UG,BIM-RPC24831-100UG,BIM-RPC24831-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20
Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ms4a1. Target Synonyms: B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20. Accession Number: P19437. Expression Region: 111~291aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Target-Kategorie: Ms4a1