Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1), Unconjugated, Yeast

Artikelnummer: BIM-RPC24871
Artikelname: Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1), Unconjugated, Yeast
Artikelnummer: BIM-RPC24871
Hersteller Artikelnummer: RPC24871
Alternativnummer: BIM-RPC24871-20UG,BIM-RPC24871-100UG,BIM-RPC24871-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Phosphohistidine phosphatase 1, Protein janus-A homolog
Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PHPT1. Target Synonyms: Phosphohistidine phosphatase 1, Protein janus-A homolog. Accession Number: Q9NRX4. Expression Region: 1~125aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 15.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 15.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Target-Kategorie: PHPT1