Recombinant Human Cardiac phospholamban (PLN), Unconjugated, Yeast

Artikelnummer: BIM-RPC24881
Artikelname: Recombinant Human Cardiac phospholamban (PLN), Unconjugated, Yeast
Artikelnummer: BIM-RPC24881
Hersteller Artikelnummer: RPC24881
Alternativnummer: BIM-RPC24881-20UG,BIM-RPC24881-100UG,BIM-RPC24881-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cardiac phospholamban, CMD1P, CMH18, PLB, Pln, PPLA_HUMAN
Recombinant Human Cardiac phospholamban (PLN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PLN. Target Synonyms: Cardiac phospholamban, CMD1P, CMH18, PLB, Pln, PPLA_HUMAN. Accession Number: P26678. Expression Region: 1~52aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.1kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Target-Kategorie: PLN