Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC24955
Artikelname: Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC24955
Hersteller Artikelnummer: RPC24955
Alternativnummer: BIM-RPC24955-20UG,BIM-RPC24955-100UG,BIM-RPC24955-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: D-serine transporterSolute carrier family 7 member 10
Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Slc7a10. Target Synonyms: D-serine transporterSolute carrier family 7 member 10. Accession Number: P63115. Expression Region: 475~530aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 22.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.5kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ
Target-Kategorie: Slc7a10