Recombinant Mouse Osteopontin (Spp1), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC24965
Artikelname: Recombinant Mouse Osteopontin (Spp1), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC24965
Hersteller Artikelnummer: RPC24965
Alternativnummer: BIM-RPC24965-20UG,BIM-RPC24965-100UG,BIM-RPC24965-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: 2ARBone sialoprotein 1Calcium oxalate crystal growth inhibitor protein, Early T-lymphocyte activation 1 protein, Minopontin, Secreted phosphoprotein 1, SPP-1
Recombinant Mouse Osteopontin (Spp1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Spp1. Target Synonyms: 2ARBone sialoprotein 1Calcium oxalate crystal growth inhibitor protein, Early T-lymphocyte activation 1 protein, Minopontin, Secreted phosphoprotein 1, SPP-1. Accession Number: P10923. Expression Region: 17~290aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLVLDPKS
Target-Kategorie: Spp1