Recombinant Human Small proline-rich protein 2B (SPRR2B), Unconjugated, Yeast

Artikelnummer: BIM-RPC24967
Artikelname: Recombinant Human Small proline-rich protein 2B (SPRR2B), Unconjugated, Yeast
Artikelnummer: BIM-RPC24967
Hersteller Artikelnummer: RPC24967
Alternativnummer: BIM-RPC24967-20UG,BIM-RPC24967-100UG,BIM-RPC24967-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: SPRR2B, Small proline-rich protein 2B, SPR-2B
Recombinant Human Small proline-rich protein 2B (SPRR2B) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SPRR2B. Target Synonyms: SPRR2B, Small proline-rich protein 2B, SPR-2B. Accession Number: P35325. Expression Region: 1~72aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 12kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 12kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Target-Kategorie: SPRR2B