Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25060
Artikelname: Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25060
Hersteller Artikelnummer: RPC25060
Alternativnummer: BIM-RPC25060-20UG,BIM-RPC25060-100UG,BIM-RPC25060-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: H. pylori
Konjugation: Unconjugated
Alternative Synonym: Glutamyl-tRNA synthetase 1
Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Target Name: gltX1. Target Synonyms: Glutamyl-tRNA synthetase 1. Accession Number: P96551. Expression Region: 1~463aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 55.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 55.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMG
Target-Kategorie: gltX1