Recombinant Mouse Major urinary protein 2 (Mup2), Unconjugated, Yeast

Artikelnummer: BIM-RPC25090
Artikelname: Recombinant Mouse Major urinary protein 2 (Mup2), Unconjugated, Yeast
Artikelnummer: BIM-RPC25090
Hersteller Artikelnummer: RPC25090
Alternativnummer: BIM-RPC25090-20UG,BIM-RPC25090-100UG,BIM-RPC25090-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Mup2, Major urinary protein 2, MUP 2
Recombinant Mouse Major urinary protein 2 (Mup2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Mup2. Target Synonyms: Mup2, Major urinary protein 2, MUP 2. Accession Number: P11589. Expression Region: 19~180aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 20.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE
Target-Kategorie: Mup2