Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25117
Artikelname: Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25117
Hersteller Artikelnummer: RPC25117
Alternativnummer: BIM-RPC25117-20UG,BIM-RPC25117-100UG,BIM-RPC25117-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: AaLtalktA
Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans). Target Name: ltxA. Target Synonyms: AaLtalktA. Accession Number: P16462. Expression Region: 721~1055aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 38.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 38.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNK
Target-Kategorie: ltxA