Recombinant Vicia faba Legumin type B (LEB6), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25121
Artikelname: Recombinant Vicia faba Legumin type B (LEB6), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25121
Hersteller Artikelnummer: RPC25121
Alternativnummer: BIM-RPC25121-20UG,BIM-RPC25121-100UG,BIM-RPC25121-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Legumin type B acidic chain
Recombinant Vicia faba Legumin type B (LEB6), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vicia faba (Broad bean) (Faba vulgaris). Target Name: LEB6. Target Synonyms: Legumin type B acidic chain. Accession Number: P16079. Expression Region: 1~148aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN
Target-Kategorie: LEB6