Recombinant Vaccinia virus Protein K3 (VACWR034), Unconjugated, Yeast

Artikelnummer: BIM-RPC25124
Artikelname: Recombinant Vaccinia virus Protein K3 (VACWR034), Unconjugated, Yeast
Artikelnummer: BIM-RPC25124
Hersteller Artikelnummer: RPC25124
Alternativnummer: BIM-RPC25124-20UG,BIM-RPC25124-100UG,BIM-RPC25124-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Protein K2
Recombinant Vaccinia virus Protein K3 (VACWR034) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Target Name: VACWR034. Target Synonyms: Protein K2. Accession Number: P18378. Expression Region: 1~88aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 12.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 12.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Target-Kategorie: VACWR034